PRG4 (Human) Recombinant Protein (Q01)
Catalog Number:
ABN-H00010216-Q01
Article Name: |
PRG4 (Human) Recombinant Protein (Q01) |
Biozol Catalog Number: |
ABN-H00010216-Q01 |
Supplier Catalog Number: |
H00010216-Q01 |
Alternative Catalog Number: |
ABN-H00010216-Q01-10,ABN-H00010216-Q01-25 |
Manufacturer: |
Abnova |
Category: |
Proteine/Peptide |
Application: |
AP, Array, ELISA, WB |
Species Reactivity: |
Human |
Human PRG4 partial ORF ( NP_005798, 1305 a.a. - 1404 a.a.) recombinant protein with GST-tag at N-terminal. |
Tag: |
GST |
UniProt: |
10216 |
Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Sequence: |
ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP |
Target: |
PRG4 |