LRRC17 (Human) Recombinant Protein (P01)
Catalog Number:
ABN-H00010234-P01
| Article Name: |
LRRC17 (Human) Recombinant Protein (P01) |
| Biozol Catalog Number: |
ABN-H00010234-P01 |
| Supplier Catalog Number: |
H00010234-P01 |
| Alternative Catalog Number: |
ABN-H00010234-P01-10,ABN-H00010234-P01-25 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Species Reactivity: |
Human |
| Human LRRC17 full-length ORF ( AAH27903, 19 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal. |
| Tag: |
GST |
| UniProt: |
10234 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVK |
| Target: |
LRRC17 |
