C1D (Human) Recombinant Protein (P02)
Catalog Number:
ABN-H00010438-P02
Article Name: |
C1D (Human) Recombinant Protein (P02) |
Biozol Catalog Number: |
ABN-H00010438-P02 |
Supplier Catalog Number: |
H00010438-P02 |
Alternative Catalog Number: |
ABN-H00010438-P02-10,ABN-H00010438-P02-25 |
Manufacturer: |
Abnova |
Category: |
Proteine/Peptide |
Application: |
AP, Array, ELISA, WB |
Species Reactivity: |
Human |
Human C1D full-length ORF ( AAH05235, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. |
Tag: |
GST |
UniProt: |
10438 |
Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Sequence: |
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS |
Target: |
C1D |