SMA4 (Human) Recombinant Protein (P03)
Catalog Number:
ABN-H00011039-P03
| Article Name: |
SMA4 (Human) Recombinant Protein (P03) |
| Biozol Catalog Number: |
ABN-H00011039-P03 |
| Supplier Catalog Number: |
H00011039-P03 |
| Alternative Catalog Number: |
ABN-H00011039-P03-10,ABN-H00011039-P03-25 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Species Reactivity: |
Human |
| Human SMA4 full-length ORF ( AAH02622.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
| Tag: |
GST |
| UniProt: |
11039 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV |
| Target: |
SMA4 |
