TAS2R9 (Human) Recombinant Protein

Catalog Number: ABN-H00050835-G01
Article Name: TAS2R9 (Human) Recombinant Protein
Biozol Catalog Number: ABN-H00050835-G01
Supplier Catalog Number: H00050835-G01
Alternative Catalog Number: ABN-H00050835-G01-10
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP
Species Reactivity: Human
Human TAS2R9 full-length ORF (NP_076406.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 50835
Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Form: Liquid
Sequence: MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLISLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSS
Target: TAS2R9
Application Dilute: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.