TGFB1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7005
Article Name: TGFB1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7005
Supplier Catalog Number: P7005
Alternative Catalog Number: ABN-P7005-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human TGFB1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7040
Buffer: Lyophilized from PBS, pH 8.0.
Form: Lyophilized
Sequence: MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Target: TGFB1
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.