THPO (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7007
Article Name: THPO (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7007
Supplier Catalog Number: P7007
Alternative Catalog Number: ABN-P7007-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human THPO recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7066
Buffer: Lyophilized from PBS, pH 7.4.
Form: Lyophilized
Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
Target: THPO
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.