TNFSF9 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7010
Article Name: TNFSF9 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7010
Supplier Catalog Number: P7010
Alternative Catalog Number: ABN-P7010-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human TNFSF9 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Tag: His
UniProt: 8744
Buffer: Lyophilized from PBS, pH 7.4.
Form: Lyophilized
Sequence: MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Target: TNFSF9
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.