KITLG (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7012
Article Name: KITLG (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7012
Supplier Catalog Number: P7012
Alternative Catalog Number: ABN-P7012-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human KITLG recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Tag: His
UniProt: 4254
Buffer: Lyophilized from PBS, pH 7.4.
Form: Lyophilized
Sequence: MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Target: KITLG
Application Dilute: SDS-PAGEThe optimal working dilution should be determined by the end user.