CSF1 (Human) Recombinant Protein, Mammal
Catalog Number:
ABN-P7105
| Article Name: |
CSF1 (Human) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P7105 |
| Supplier Catalog Number: |
P7105 |
| Alternative Catalog Number: |
ABN-P7105-10 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Human CSF1 (P09603, 33 a.a - 190 a.a) partial recombinant protein expressed in CHO cells. |
| Tag: |
None |
| UniProt: |
1435 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN |
| Target: |
CSF1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
