IFNG (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7111
Article Name: IFNG (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7111
Supplier Catalog Number: P7111
Alternative Catalog Number: ABN-P7111-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human IFNG (P01579, 24 a.a. - 166 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 3458
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Target: IFNG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.