CNTF (Human) Recombinant Protein

Catalog Number: ABN-P7122
Article Name: CNTF (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7122
Supplier Catalog Number: P7122
Alternative Catalog Number: ABN-P7122-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 1270
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Target: CNTF
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.