VEGFA (Human) Recombinant Protein

Catalog Number: ABN-P7123
Article Name: VEGFA (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7123
Supplier Catalog Number: P7123
Alternative Catalog Number: ABN-P7123-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Human VEGFA (P15692-4, 27 a.a. - 191 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 7422
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: CHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Target: VEGFA
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.