Il4 (Porcine) Recombinant Protein, Mammal
Catalog Number:
ABN-P7268
| Article Name: |
Il4 (Porcine) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P7268 |
| Supplier Catalog Number: |
P7268 |
| Alternative Catalog Number: |
ABN-P7268-10 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Porcine |
| Porcine IL4 (Q04745, 25 a.a. - 133 a.a.) partial recombinant protein expressed in CHO cells. |
| Tag: |
None |
| UniProt: |
397225 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
| Target: |
IL4 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
