Tnfsf13 (Mouse) Recombinant Protein, E. coli

Product Overview

• Article Name: Tnfsf13 (Mouse) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P7297
• Supplier Catalog Number: P7297
• Alternative Catalog Number: ABN-P7297-10
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE
• Species Reactivity: Mouse

Product Description

Mouse Tnfsf13 (Q9D777, 50 a.a. - 241 a.a.) partial recombinant protein expressed in Escherichia coli.

Product Properties

• Tag: None
• UniProt: 69583
• Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
• Form: Lyophilized
• Sequence: MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
• Target: Tnfsf13

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.