CXCL10 (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: CXCL10 (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P7298
• Supplier Catalog Number: P7298
• Alternative Catalog Number: ABN-P7298-10
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human CXCL10 (P02778, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.

Product Properties

• Tag: None
• UniProt: 3627
• Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
• Form: Lyophilized
• Sequence: MVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Target: CXCL10

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.