EPO (Human) Recombinant Protein, Mammal

Product Overview

• Article Name: EPO (Human) Recombinant Protein, Mammal
• Biozol Catalog Number: ABN-P7301
• Supplier Catalog Number: P7301
• Alternative Catalog Number: ABN-P7301-10
• Manufacturer: Abnova
• Host: Mammal
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human EPO (P01588, 28 a.a. - 193 a.a.) partial recombinant protein expressed in CHO cells.

Product Properties

• Tag: None
• UniProt: 2056
• Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
• Form: Lyophilized
• Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
• Target: EPO

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.