Csf2 (Mouse) Recombinant Protein, Mammal

Catalog Number: ABN-P7303
Article Name: Csf2 (Mouse) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7303
Supplier Catalog Number: P7303
Alternative Catalog Number: ABN-P7303-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Mouse
Mouse Csf2 (Q14AD9, 18 a.a. - 141 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 12981
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Target: Csf2
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.