Shh (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P7307
Article Name: Shh (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7307
Supplier Catalog Number: P7307
Alternative Catalog Number: ABN-P7307-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Mouse
Mouse Shh (Q62226, 25 a.a. - 198 a.a.) C25IVI mutant partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 20423
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: LVLGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG1VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Target: Shh
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.