Shh (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P7307
Article Name: |
Shh (Mouse) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P7307 |
Supplier Catalog Number: |
P7307 |
Alternative Catalog Number: |
ABN-P7307-10 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Mouse |
Mouse Shh (Q62226, 25 a.a. - 198 a.a.) C25IVI mutant partial recombinant protein expressed in Escherichia coli. |
Tag: |
None |
UniProt: |
20423 |
Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
LVLGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG1VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Target: |
Shh |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |