Csf1 (Rat) Recombinant Protein, Hamster
Catalog Number:
ABN-P7320
| Article Name: |
Csf1 (Rat) Recombinant Protein, Hamster |
| Biozol Catalog Number: |
ABN-P7320 |
| Supplier Catalog Number: |
P7320 |
| Alternative Catalog Number: |
ABN-P7320-5 |
| Manufacturer: |
Abnova |
| Host: |
Hamster |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Rat |
| Rat Csf1 (Q8JZQ0, 33 a.a. - 186 a.a.) partial recombinant protein expressed in CHO cells. |
| UniProt: |
78965 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP |
| Target: |
Csf1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
