Csf1 (Rat) Recombinant Protein, Hamster
Catalog Number:
ABN-P7320
Article Name: |
Csf1 (Rat) Recombinant Protein, Hamster |
Biozol Catalog Number: |
ABN-P7320 |
Supplier Catalog Number: |
P7320 |
Alternative Catalog Number: |
ABN-P7320-5 |
Manufacturer: |
Abnova |
Host: |
Hamster |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Rat |
Rat Csf1 (Q8JZQ0, 33 a.a. - 186 a.a.) partial recombinant protein expressed in CHO cells. |
UniProt: |
78965 |
Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP |
Target: |
Csf1 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |