IL6 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7332
Article Name: |
IL6 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P7332 |
Supplier Catalog Number: |
P7332 |
Alternative Catalog Number: |
ABN-P7332-10 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Human |
Human IL6 (Q75MH2, 29 a.a. - 212 a.a ) partial recombinant protein expressed in Escherichia coli. |
UniProt: |
3569 |
Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Target: |
IL6 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |