Shh (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P7337
Article Name: Shh (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7337
Supplier Catalog Number: P7337
Alternative Catalog Number: ABN-P7337-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Mouse
Mouse Shh (Q62226, 25 a.a. - 198 a.a.) C25II mutant partial recombinant protein expressed in Escherichia coli.
UniProt: 20423
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: IIPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Target: Shh
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.