NRG1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7338
| Article Name: |
NRG1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7338 |
| Supplier Catalog Number: |
P7338 |
| Alternative Catalog Number: |
ABN-P7338-10 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human NRG1 (Q02297, 177 a.a. - 241 a.a ) partial recombinant protein expressed in Escherichia coli. |
| UniProt: |
3084 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK |
| Target: |
NRG1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
