SHH (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7339
Article Name: SHH (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7339
Supplier Catalog Number: P7339
Alternative Catalog Number: ABN-P7339-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human SHH (Q15465, 24 a.a. - 197 a.a ) C24II mutant partial recombinant protein expressed in Escherichia coli.
UniProt: 6469
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: IIPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Target: SHH
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.