S100A1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7349
Article Name: |
S100A1 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P7349 |
Supplier Catalog Number: |
P7349 |
Alternative Catalog Number: |
ABN-P7349-5 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Human |
Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli. |
Tag: |
with N-terminal His tagged |
UniProt: |
6271 |
Buffer: |
Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH2O at 200 µg/ml. |
Form: |
Lyophilized |
Sequence: |
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Target: |
S100A1 |
Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |