S100A1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7350
| Article Name: |
S100A1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7350 |
| Supplier Catalog Number: |
P7350 |
| Alternative Catalog Number: |
ABN-P7350-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli. |
| Tag: |
with N-terminal His tagged |
| UniProt: |
6271 |
| Buffer: |
Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH2O at 200 µg/ml. |
| Form: |
Lyophilized |
| Sequence: |
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
| Target: |
S100A1 |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
