IL22 (Human) Recombinant Protein
Catalog Number:
ABN-P7351
| Article Name: |
IL22 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P7351 |
| Supplier Catalog Number: |
P7351 |
| Alternative Catalog Number: |
ABN-P7351-50 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL22 (Q9GZX6, 34 a.a. - 179 a.a ) partial recombinant protein expressed in HEK293 cells. |
| UniProt: |
50616 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Target: |
IL22 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
