BTC (Human) Recombinant Protein

Catalog Number: ABN-P7361
Article Name: BTC (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7361
Supplier Catalog Number: P7361
Alternative Catalog Number: ABN-P7361-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human BTC (P35070, 32 a.a. - 111 a.a ) partial recombinant protein expressed in HEK293 cells.
UniProt: 685
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Target: BTC
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.