AREG (Human) Recombinant Protein

Catalog Number: ABN-P7362
Article Name: AREG (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7362
Supplier Catalog Number: P7362
Alternative Catalog Number: ABN-P7362-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human AREG (P15514, 101 a.a. - 198 a.a ) partial recombinant protein expressed in HEK293 cells.
UniProt: 374
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Target: AREG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.