TNFRSF1A (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7363
Article Name: TNFRSF1A (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7363
Supplier Catalog Number: P7363
Alternative Catalog Number: ABN-P7363-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human TNFRSF1A (P19438, 50 a.a. - 211 a.a ) partial recombinant protein expressed in CHO cells.
UniProt: 7132
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: IHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Target: TNFRSF1A
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.