IFNB1 (Human) Recombinant Protein

Catalog Number: ABN-P7366
Article Name: IFNB1 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7366
Supplier Catalog Number: P7366
Alternative Catalog Number: ABN-P7366-5
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human IFNB1 (P01574, 22 a.a. - 187 a.a ) partial recombinant protein expressed in HEK293 cells.
UniProt: 3456
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Target: IFNB1
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.