OSM (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7375
Article Name: OSM (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7375
Supplier Catalog Number: P7375
Alternative Catalog Number: ABN-P7375-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human OSM (P13725, 26 a.a. - 234 a.a ) partial recombinant protein expressed in Escherichia coli.
UniProt: 5008
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Target: OSM
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.