TNFSF12 (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7376
Article Name: TNFSF12 (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7376
Supplier Catalog Number: P7376
Alternative Catalog Number: ABN-P7376-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human TNFSF12 (Q4ACW9, 99 a.a. - 249 a.a ) partial recombinant protein expressed in CHO cells.
UniProt: 8742
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Target: TNFSF12
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.