Btc (Mouse) Recombinant Protein, Human

Catalog Number: ABN-P7382
Article Name: Btc (Mouse) Recombinant Protein, Human
Biozol Catalog Number: ABN-P7382
Supplier Catalog Number: P7382
Alternative Catalog Number: ABN-P7382-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Mouse
Mouse Btc (Q543J8, 32 a.a. - 111 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 12223
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQT PSCICEKGYFGARCERVDLFY
Target: Btc
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.