IL1RN (Human) Recombinant Protein

Catalog Number: ABN-P7384
Article Name: IL1RN (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7384
Supplier Catalog Number: P7384
Alternative Catalog Number: ABN-P7384-10
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human IL1RN (P18510, 26 a.a. - 177 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 3557
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Target: IL1RN
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.