Il10 (Rat) Recombinant Protein, Mammal

Catalog Number: ABN-P7385
Article Name: Il10 (Rat) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7385
Supplier Catalog Number: P7385
Alternative Catalog Number: ABN-P7385-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Rat
Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant Protein expressed in CHO cells.
Tag: None
UniProt: 25325
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Target: Il10
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.