CCL5 (Human) Recombinant Protein
Catalog Number:
ABN-P7393
Article Name: |
CCL5 (Human) Recombinant Protein |
Biozol Catalog Number: |
ABN-P7393 |
Supplier Catalog Number: |
P7393 |
Alternative Catalog Number: |
ABN-P7393-5 |
Manufacturer: |
Abnova |
Host: |
Human |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Human |
Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in HEK293 cells. |
Tag: |
None |
UniProt: |
6352 |
Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Target: |
CCL5 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |