PPBP (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7395
Article Name: PPBP (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7395
Supplier Catalog Number: P7395
Alternative Catalog Number: ABN-P7395-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human PPBP (P02775, 59 a.a. - 128 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 5473
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Target: PPBP
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.