CXCL5 (Human) Recombinant Protein

Catalog Number: ABN-P7396
Article Name: CXCL5 (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7396
Supplier Catalog Number: P7396
Alternative Catalog Number: ABN-P7396-5
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human CXCL5 (P42830, 37 a.a. - 114 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 6374
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Target: CXCL5
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.