CNTF (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7400
Article Name: CNTF (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7400
Supplier Catalog Number: P7400
Alternative Catalog Number: ABN-P7400-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human CNTF (P26441-1, 2 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 1270
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Form: Lyophilized
Sequence: AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Target: CNTF
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.