VEGFA (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7401
Article Name: VEGFA (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7401
Supplier Catalog Number: P7401
Alternative Catalog Number: ABN-P7401-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human VEGFA (P15692-9, 28 a.a. - 147 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 7422
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Form: Lyophilized
Sequence: PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGK
Target: VEGFA
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.