HBEGF (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7402
Article Name: HBEGF (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7402
Supplier Catalog Number: P7402
Alternative Catalog Number: ABN-P7402-5
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 1839
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Form: Lyophilized
Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Target: HBEGF
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.