Igf1 (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P7405
| Article Name: |
Igf1 (Rat) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7405 |
| Supplier Catalog Number: |
P7405 |
| Alternative Catalog Number: |
ABN-P7405-10 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Rat |
| Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Tag: |
None |
| UniProt: |
24482 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA |
| Target: |
Igf1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
