IL4R (Human) Recombinant Protein
Catalog Number:
ABN-P7408
| Article Name: |
IL4R (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P7408 |
| Supplier Catalog Number: |
P7408 |
| Alternative Catalog Number: |
ABN-P7408-10 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL4R (P24394, 24 a.a. - 232 a.a.) partial recombinant protein expressed in HEK293 cells. |
| Tag: |
None |
| UniProt: |
3566 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Target: |
IL4R |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
