TGFA (Human) Recombinant Protein

Catalog Number: ABN-P7409
Article Name: TGFA (Human) Recombinant Protein
Biozol Catalog Number: ABN-P7409
Supplier Catalog Number: P7409
Alternative Catalog Number: ABN-P7409-5
Manufacturer: Abnova
Host: Human
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human TGFA (P01135, 40 a.a. - 89 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 7039
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Form: Lyophilized
Sequence: VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Target: TGFA
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.