IL3 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7412
| Article Name: |
IL3 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7412 |
| Supplier Catalog Number: |
P7412 |
| Alternative Catalog Number: |
ABN-P7412-10 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL3 (P08700, 20 a.a. - 152 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli. |
| Tag: |
None |
| UniProt: |
3562 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Target: |
IL3 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
