MIF (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P7415
Article Name: MIF (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P7415
Supplier Catalog Number: P7415
Alternative Catalog Number: ABN-P7415-10
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human MIF (P14174, 1 a.a. - 115 a.a.) full-length recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 4282
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Target: MIF
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.