CSNK2B (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7877
| Article Name: |
CSNK2B (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7877 |
| Supplier Catalog Number: |
P7877 |
| Alternative Catalog Number: |
ABN-P7877-500 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli. |
| UniProt: |
1460 |
| Buffer: |
In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA) |
| Form: |
Liquid |
| Sequence: |
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
| Target: |
CSNK2B |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
