FOLH1 (Human) Recombinant Protein, Virus
Catalog Number:
ABN-P7883
| Article Name: |
FOLH1 (Human) Recombinant Protein, Virus |
| Biozol Catalog Number: |
ABN-P7883 |
| Supplier Catalog Number: |
P7883 |
| Alternative Catalog Number: |
ABN-P7883-500 |
| Manufacturer: |
Abnova |
| Host: |
Virus |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus. |
| Tag: |
His |
| UniProt: |
2346 |
| Buffer: |
In PBS, pH 7.4 ( 20% glycerol) |
| Form: |
Liquid |
| Sequence: |
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPI |
| Target: |
FOLH1 |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
