RNASE2 (Human) Recombinant Protein, Virus
Catalog Number:
ABN-P7893
| Article Name: |
RNASE2 (Human) Recombinant Protein, Virus |
| Biozol Catalog Number: |
ABN-P7893 |
| Supplier Catalog Number: |
P7893 |
| Alternative Catalog Number: |
ABN-P7893-500 |
| Manufacturer: |
Abnova |
| Host: |
Virus |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human RNASE2 (P10153, 28 a.a. - 161 a.a.) partial recombinant protein with His tag expressed in Baculovirus. |
| Tag: |
His |
| UniProt: |
6036 |
| Buffer: |
In PBS, pH 7.4 (20% glycerol) |
| Form: |
Liquid |
| Sequence: |
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
| Target: |
RNASE2 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
